Protein Info for Rv0765c in Mycobacterium tuberculosis H37Rv

Annotation: Probable oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF00106: adh_short" amino acids 12 to 203 (192 residues), 159.9 bits, see alignment E=8.3e-51 PF08659: KR" amino acids 12 to 174 (163 residues), 44.3 bits, see alignment E=3e-15 PF13561: adh_short_C2" amino acids 17 to 238 (222 residues), 132.2 bits, see alignment E=3.6e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtu:Rv0765c)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.140

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>Rv0765c Probable oxidoreductase (Mycobacterium tuberculosis H37Rv)
MPRFEPHPARRTTVVAGASSGIGAATATELAGRGFPVALGARRMDKLAELVDKIRADGGE
AVAFPLDVTDPESVKSFVAQTVEALGEVELLVSSAGDMLPGQLHEVSTEAFAEQVQIHLV
GANRLATAVLPAMVARRRGDLIFVGSDVGLRQRPHMGAYGAAKAGLAAMVTNLQMELEGT
GVRASIVHPGPTLTGMGWQLSAEQVGPMLADWAKWGQARHNYFLRPSDLARAIAFVAETP
RGCVVVNMEIQPEAPLRDAPAHRQKLVLGEEGMPG