Protein Info for Rv0757 in Mycobacterium tuberculosis H37Rv

Annotation: Possible two component system response transcriptional positive regulator PhoP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00072: Response_reg" amino acids 23 to 132 (110 residues), 98.7 bits, see alignment E=2.4e-32 PF00486: Trans_reg_C" amino acids 169 to 243 (75 residues), 83.9 bits, see alignment E=6.6e-28

Best Hits

Swiss-Prot: 55% identical to TCRX_MYCTU: Probable transcriptional regulatory protein TcrX (tcrX) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 100% identity to mra:MRA_0767)

Predicted SEED Role

"DNA-binding response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>Rv0757 Possible two component system response transcriptional positive regulator PhoP (Mycobacterium tuberculosis H37Rv)
MRKGVDLVTAGTPGENTTPEARVLVVDDEANIVELLSVSLKFQGFEVYTATNGAQALDRA
RETRPDAVILDVMMPGMDGFGVLRRLRADGIDAPALFLTARDSLQDKIAGLTLGGDDYVT
KPFSLEEVVARLRVILRRAGKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFT
LLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVG
YVLREPR