Protein Info for Rv0755c in Mycobacterium tuberculosis H37Rv

Annotation: PPE family protein PPE12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 PF00823: PPE" amino acids 4 to 166 (163 residues), 208.9 bits, see alignment E=5.2e-66 PF01469: Pentapeptide_2" amino acids 321 to 360 (40 residues), 30.7 bits, see alignment 2.3e-11 amino acids 365 to 401 (37 residues), 31.6 bits, see alignment 1.2e-11 amino acids 403 to 441 (39 residues), 36.9 bits, see alignment 2.7e-13 amino acids 443 to 481 (39 residues), 29.9 bits, see alignment 4.2e-11 amino acids 483 to 521 (39 residues), 36.8 bits, see alignment 2.9e-13

Best Hits

Swiss-Prot: 100% identical to PPE12_MYCTO: Uncharacterized PPE family protein PPE12 (PPE12) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_10769)

Predicted SEED Role

"PPE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (645 amino acids)

>Rv0755c PPE family protein PPE12 (Mycobacterium tuberculosis H37Rv)
MVGFAWLPPETNSLRMYLGAGSRPLLAAAGAWDGLAEELHAAASSFGSVTSELAGGAWQG
PASAAMANAAGPYASWLTAAGAQAELAARQARAAAGAFEEALAGVVHPAVVQANRVRTWL
LAVSNVFGQNAPAIAAMESTYEQMWAQDVAVMAGYHAASSAAAAQLASWQPALPNINLGV
GNIGNLNVGNGNTGDYNLGNGNLGNANFGGGNGSAFHGQISSFNVGSGNIGNFNLGSGNG
NVGIGPSSFNVGSGNIGNANVGGGNSGDNNFGFGNFGNANIGIGNAGPNMSSPAVPTPGN
GNVGIGNGGNGNFGGGNTGNANIGLGNVGDGNVGFGNSGSYNFGFGNTGNNNIGIGLTGS
NQIGFGGLNSGSGNIGFGNSGTGNIGFFNSGSGNFGVGNSGVTNTGVANSGNINTGFGNS
GFINTGFGNALSVNTGFGNSGQANTGIGNAGDFNTGNFNGGIINTGSFNSGAFNSGSFNG
GDANSGFLNSGLTNTGFANSGNINTGGFNAGNLNTGFGNTTDGLGENSGFGNAGSGNSGF
NNSGRGNSGAQNVGNLQISGFANSGQSVTGYNNSVSVTSGFGNKGTGLFSGFMSGFGNTG
FLQSGFGNLEANPDNNSATSGFGNSGKQDSGGFNSIDFVSGFFHR