Protein Info for Rv0735 in Mycobacterium tuberculosis H37Rv

Annotation: Probable alternative RNA polymerase sigma factor SigL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF07638: Sigma70_ECF" amino acids 6 to 163 (158 residues), 24.3 bits, see alignment E=5.2e-09 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 15 to 168 (154 residues), 96.4 bits, see alignment E=7e-32 PF04542: Sigma70_r2" amino acids 18 to 85 (68 residues), 66.3 bits, see alignment E=3.5e-22 PF08281: Sigma70_r4_2" amino acids 114 to 166 (53 residues), 47.3 bits, see alignment E=2.5e-16 PF04545: Sigma70_r4" amino acids 119 to 167 (49 residues), 51.9 bits, see alignment E=8.5e-18

Best Hits

Swiss-Prot: 99% identical to SIGL_MYCTE: ECF RNA polymerase sigma factor SigL (sigL) from Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 99% identity to mtc:MT0759)

Predicted SEED Role

"RNA polymerase sigma-70 factor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>Rv0735 Probable alternative RNA polymerase sigma factor SigL (Mycobacterium tuberculosis H37Rv)
VARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGD
TARPARAWLFTVARNMIIDERRSARFRNVVGSTDQSGTPEQSTPDEVNAALDRLLIADAL
AQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLHYAVRALRLTLQELGVTR