Protein Info for Rv0724 in Mycobacterium tuberculosis H37Rv

Annotation: Possible protease IV SppA (endopeptidase IV) (signal peptide peptidase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 82 to 600 (519 residues), 358.5 bits, see alignment E=6e-111 PF01343: Peptidase_S49" amino acids 130 to 282 (153 residues), 158 bits, see alignment E=1.9e-50 amino acids 403 to 554 (152 residues), 175.5 bits, see alignment E=7.8e-56 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 332 to 552 (221 residues), 172.4 bits, see alignment E=1e-54

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 100% identity to mbb:BCG_0774)

Predicted SEED Role

"Possible protease IV SppA (endopeptidase IV) (signal peptide peptidase)"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (623 amino acids)

>Rv0724 Possible protease IV SppA (endopeptidase IV) (signal peptide peptidase) (Mycobacterium tuberculosis H37Rv)
MPIFGGFCVCSRALGGRWVRWVNMVAFLPSIPVVEDLRALVGRVDTARHHGVPNGCVLEF
NLRSVPPETTGFDPLTVLTGGGRPMALRDAVAAIHRAAEDPRVAGLIARVQLPPSPAGAV
QELREAIAAFSAVKPSLAWAETYPGTLSYYLASAFGEVWMQPSGSVGLVGFATNATFLRD
ALHKAGIEAQFVARGEYKSAANLFTEDGFTDAHREAVTRMLDSLQDQVWQAVAKSRNIGV
DALDELADRAPLLRDDAVTCGLIDRIGFRDQAYARMAELVGVEKGSPESSGSQTSPDEKP
PRMYLARYASSARPRLTPPVPSIPGRRSKPTIAVVTLEGPIVNGRGGPQFLPLGPSSAGG
DTIAAALREVAADDSVSAIVLRVDSPGGSVTASETIWREVARARDRGKPVVASMGAVAAS
GGYYVSMGADAIVANPGTITGSIGVITGKLVVRDLKDRLGVGSDAVRTNANADAWSIDAP
FTPDQQAHREAEADLFYSDFVERVAEGRKMTTDAVDVVARGRVWTGADALDRGLVDELGG
LRTAVRRAKVLAGLDEDTEVRIVSYPGSSLWDMVRPRPSSRPAAASLPDAMGALLARSIV
GIVEQVEQTLSGASVLWLGESRL