Protein Info for Rv0697 in Mycobacterium tuberculosis H37Rv

Annotation: Probable dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 TIGR03970: dehydrogenase, Rv0697 family" amino acids 8 to 479 (472 residues), 761.8 bits, see alignment E=1.7e-233 PF00732: GMC_oxred_N" amino acids 9 to 298 (290 residues), 111.3 bits, see alignment E=9.1e-36 PF05199: GMC_oxred_C" amino acids 358 to 471 (114 residues), 105.1 bits, see alignment E=7.2e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_10711)

Predicted SEED Role

"Dehydrogenase in mycofactocin cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>Rv0697 Probable dehydrogenase (Mycobacterium tuberculosis H37Rv)
VTAAVRHSDVLVVGAGSAGSVVAERLSMDSSCVVTVLEAGPGLADPGLLAQTANGLQLPI
GAGSPLVERYRTRLTDRPVRHLPIVRGATVGGSGAINGGYFCRGLPSDFDRASIPGWAWS
DVLEHFRAIETDLDFETPVHGRSGPIPVRRTHEMTGITESFMAAAEDAGFAWIADLNDVG
PEMPSGVGAVPLNIVNGVRTSSAVGYLMPALGRPNLTLLARTRAVRLRFSATTAVGVDAI
GPGGPVSLSADRIVLCAGAIQSAHLLMLSGVGEEEVLRSAGVKVLMALPVGMGCSDHPEW
VMPTNWAVAVDRPVLEVLLSTHDGIEIRPYTGGFVAMTGDGTAGHRDWPHIGVALMQPRA
RGRITLVSSDPQIPVRIEHRYDSEPADVAALRQGSALAHELCGAATRIGPAVWATSQHLC
GSAPMGTDDDPRAVVDPRCRVRGIENLWVIDGSVLPSITSRGPHATIVMLGHRAAEFVQ