Protein Info for Rv0676c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane transport protein MmpL5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 964 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 302 to 327 (26 residues), see Phobius details amino acids 339 to 363 (25 residues), see Phobius details amino acids 385 to 408 (24 residues), see Phobius details amino acids 774 to 793 (20 residues), see Phobius details amino acids 800 to 825 (26 residues), see Phobius details amino acids 832 to 854 (23 residues), see Phobius details amino acids 874 to 897 (24 residues), see Phobius details amino acids 910 to 937 (28 residues), see Phobius details TIGR00833: transport protein" amino acids 31 to 940 (910 residues), 1060.9 bits, see alignment E=0 PF03176: MMPL" amino acids 63 to 393 (331 residues), 409 bits, see alignment E=6.8e-127 amino acids 615 to 949 (335 residues), 371.5 bits, see alignment E=1.7e-115

Best Hits

Swiss-Prot: 100% identical to MMPL5_MYCTU: Siderophore exporter MmpL5 (mmpL5) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K06994, putative drug exporter of the RND superfamily (inferred from 100% identity to mbb:BCG_0725c)

Predicted SEED Role

"Transmembrane transport protein MmpL5"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (964 amino acids)

>Rv0676c Probable conserved transmembrane transport protein MmpL5 (Mycobacterium tuberculosis H37Rv)
MIVQRTAAPTGSVPPDRHAARPFIPRMIRTFAVPIILGWLVTIAVLNVTVPQLETVGQIQ
AVSMSPDAAPSMISMKHIGKVFEEGDSDSAAMIVLEGQRPLGDAAHAFYDQMIGRLQADT
THVQSLQDFWGDPLTATGAQSSDGKAAYVQVKLAGNQGESLANESVEAVKTIVERLAPPP
GVKVYVTGSAALVADQQQAGDRSLQVIEAVTFTVIIVMLLLVYRSIITSAIMLTMVVLGL
LATRGGVAFLGFHRIIGLSTFATNLLVVLAIAAATDYAIFLIGRYQEARGLGQDRESAYY
TMFGGTAHVVLGSGLTIAGATFCLSFTRLPYFQTLGVPLAIGMVIVVAAALTLGPAIIAV
TSRFGKLLEPKRMARVRGWRKVGAAIVRWPGPILVGAVALALVGLLTLPGYRTNYNDRNY
LPADLPANEGYAAAERHFSQARMNPEVLMVESDHDMRNSADFLVINKIAKAIFAVEGISR
VQAITRPDGKPIEHTSIPFLISMQGTSQKLTEKYNQDLTARMLEQVNDIQSNIDQMERMH
SLTQQMADVTHEMVIQMTGMVVDVEELRNHIADFDDFFRPIRSYFYWEKHCYDIPVCWSL
RSVFDTLDGIDVMTEDINNLLPLMQRLDTLMPQLTAMMPEMIQTMKSMKAQMLSMHSTQE
GLQDQMAAMQEDSAAMGEAFDASRNDDSFYLPPEVFDNPDFQRGLEQFLSPDGHAVRFII
SHEGDPMSQAGIARIAKIKTAAKEAIKGTPLEGSAIYLGGTAAMFKDLSDGNTYDLMIAG
ISALCLIFIIMLITTRSVVAAAVIVGTVVLSLGASFGLSVLIWQHILGIELHWLVLAMAV
IILLAVGADYNLLLVARLKEEIHAGINTGIIRAMGGSGSVVTAAGLVFAFTMMSFAVSEL
TVMAQVGTTIGMGLLFDTLIVRSFMTPSIAALLGKWFWWPQVVRQRPIPQPWPSPASART
FALV