Protein Info for Rv0642c in Mycobacterium tuberculosis H37Rv

Annotation: Methoxy mycolic acid synthase 4 MmaA4 (methyl mycolic acid synthase 4) (MMA4) (hydroxy mycolic acid synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF02353: CMAS" amino acids 13 to 290 (278 residues), 401.4 bits, see alignment E=4.8e-124 PF13489: Methyltransf_23" amino acids 68 to 201 (134 residues), 38.6 bits, see alignment E=2.4e-13 PF08241: Methyltransf_11" amino acids 78 to 173 (96 residues), 30.2 bits, see alignment E=1.4e-10 PF08242: Methyltransf_12" amino acids 78 to 172 (95 residues), 31.3 bits, see alignment E=7.1e-11 PF13649: Methyltransf_25" amino acids 78 to 171 (94 residues), 38.9 bits, see alignment E=3e-13

Best Hits

Swiss-Prot: 100% identical to MMAA4_MYCTA: Hydroxymycolate synthase MmaA4 (mmaA4) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 100% identity to mtf:TBFG_10655)

MetaCyc: 57% identical to methoxy mycolic acid synthase 2 (Mycobacterium tuberculosis H37Rv)
Cyclopropane-fatty-acyl-phospholipid synthase. [EC: 2.1.1.79]; 2.1.1.79 [EC: 2.1.1.79]; 2.1.1.79 [EC: 2.1.1.79]; 2.1.1.79 [EC: 2.1.1.79]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>Rv0642c Methoxy mycolic acid synthase 4 MmaA4 (methyl mycolic acid synthase 4) (MMA4) (hydroxy mycolic acid synthase) (Mycobacterium tuberculosis H37Rv)
MTRMAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYA
KVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQVLASID
TNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVS
YHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPH
YIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAA
A