Protein Info for Rv0634B in Mycobacterium tuberculosis H37Rv

Annotation: 50S ribosomal protein L33 RpmG2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 55 TIGR01023: ribosomal protein bL33" amino acids 6 to 55 (50 residues), 73.8 bits, see alignment E=5.4e-25 PF00471: Ribosomal_L33" amino acids 10 to 55 (46 residues), 84.2 bits, see alignment E=3.1e-28

Best Hits

Swiss-Prot: 100% identical to RL332_MYCTO: 50S ribosomal protein L33 2 (rpmG2) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K02913, large subunit ribosomal protein L33 (inferred from 91% identity to nfa:nfa51190)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (55 amino acids)

>Rv0634B 50S ribosomal protein L33 RpmG2 (Mycobacterium tuberculosis H37Rv)
MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNCGKHQAHRETR