Protein Info for Rv0599c in Mycobacterium tuberculosis H37Rv

Annotation: Possible antitoxin VapB27

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 78 TIGR01439: transcriptional regulator, AbrB family" amino acids 3 to 43 (41 residues), 49.2 bits, see alignment E=1.6e-17 PF04014: MazE_antitoxin" amino acids 5 to 45 (41 residues), 37.3 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 100% identical to VPB27_MYCTU: Antitoxin VapB27 (vapB27) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00607)

Predicted SEED Role

"FIG00820380: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (78 amino acids)

>Rv0599c Possible antitoxin VapB27 (Mycobacterium tuberculosis H37Rv)
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATG
ETTIDDEVVFGLIDSGRK