Protein Info for Rv0506 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved membrane protein MmpS2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF05423: Mycobact_memb" amino acids 10 to 146 (137 residues), 214.6 bits, see alignment E=2.4e-68

Best Hits

Swiss-Prot: 100% identical to MMPS2_MYCBO: Probable transport accessory protein MmpS2 (mmpS2) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtc:MT0527)

Predicted SEED Role

"membrane protein, MmpS family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>Rv0506 Probable conserved membrane protein MmpS2 (Mycobacterium tuberculosis H37Rv)
VRMISVSGAVKRMWLLLAIVVVAVVGGLGIYRLHSIFGVHEQPTVMVKPDFDVPLFNPKR
VTYEVFGPAKTAKIAYLDPDARVHRLDSVSLPWSVTVETTLPAVSVNLMAQSNADVISCR
IIVNGAVKDERSETSPRALTSCQVSSG