Protein Info for Rv0489 in Mycobacterium tuberculosis H37Rv

Annotation: Probable phosphoglycerate mutase 1 Gpm1 (phosphoglyceromutase) (PGAM) (BPG-dependent PGAM)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR01258: phosphoglycerate mutase 1 family" amino acids 6 to 248 (243 residues), 377.1 bits, see alignment E=1.7e-117 PF00300: His_Phos_1" amino acids 7 to 135 (129 residues), 95.6 bits, see alignment E=1.6e-31

Best Hits

Swiss-Prot: 100% identical to GPMA_MYCTA: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 100% identity to mtc:MT0508)

MetaCyc: 64% identical to phosphoglycerate mutase (Saccharomyces cerevisiae)
RXN-15513 [EC: 5.4.2.11]

Predicted SEED Role

"Phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1 or 5.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>Rv0489 Probable phosphoglycerate mutase 1 Gpm1 (phosphoglyceromutase) (PGAM) (BPG-dependent PGAM) (Mycobacterium tuberculosis H37Rv)
MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLRVGKTVLI
VAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDPEAAAAGA
AAVAGQGRG