Protein Info for Rv0472c in Mycobacterium tuberculosis H37Rv

Annotation: Probable transcriptional regulatory protein (possibly TetR-family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00440: TetR_N" amino acids 32 to 74 (43 residues), 33.8 bits, see alignment 2.3e-12 PF19344: TetR_C_32" amino acids 89 to 207 (119 residues), 30.7 bits, see alignment E=3.1e-11

Best Hits

Swiss-Prot: 100% identical to Y472_MYCTU: Uncharacterized HTH-type transcriptional regulator Rv0472c (Rv0472c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 99% identity to mbb:BCG_0513c)

Predicted SEED Role

"Transcriptional regulator, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>Rv0472c Probable transcriptional regulatory protein (possibly TetR-family) (Mycobacterium tuberculosis H37Rv)
VAERIPAVTVKTDGRKRRWHQHKVERRNELVDGTIEAIRRHGRFLSMDEIAAEIGVSKTV
LYRYFVDKNDLTTAVMMRFTQTTLIPNMIAALSADMDGFELTREIIRVYVETVAAQPEPY
RFVMANSSASKSKVIADSERIIARMLAVMLRRRMQEAGMDTGGVEPWAYLIVGGVQLATH
SWMSDPRMSSDELIDYLTMLSWSALCGIVEAGGSLEKFREQPHPSPIVPAWGQV