Protein Info for Rv0467 in Mycobacterium tuberculosis H37Rv

Annotation: Isocitrate lyase Icl (isocitrase) (isocitratase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01346: isocitrate lyase
  • amino acids 11 to 251 (241 residues), 361.4 bits, E=3.4e-112
  • amino acids 252 to 427 (176 residues), 287.6 bits, E=8.1e-90
• PF00463: ICL
  • amino acids 12 to 251 (240 residues), 179.4 bits, E=1.1e-56
  • amino acids 252 to 426 (175 residues), 162.1 bits, E=1.9e-51
• PF13714: PEP_mutase
  • amino acids 72 to 302 (231 residues), 55.2 bits, E=8.1e-19

Best Hits

Swiss-Prot: 100% identical to ACEA1_MYCBO: Isocitrate lyase 1 (icl) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 100% identity to mtb:TBMG_00469)

MetaCyc: 100% identical to isocitrate lyase subunit (Mycobacterium tuberculosis H37Rv)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.1

Use Curated BLAST to search for 4.1.3.1

Protein Sequence (428 amino acids)

>Rv0467 Isocitrate lyase Icl (isocitrase) (isocitratase) (Mycobacterium tuberculosis H37Rv)
MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEEHTLARRGAEVLWEQL
HDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALQRADQIAKIEGDTSVENWLAPIVADGEAGFGGALNVYELQKALIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSD
VDERDQPFITGERTREGFYRTKNGIEPCIARAKAYAPFADLIWMETGTPDLEAARQFSEA
VKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITLAGFHALNYSMFD
LAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPNSSTTALTG
STEEGQFH