Protein Info for Rv0462 in Mycobacterium tuberculosis H37Rv

Annotation: Dihydrolipoamide dehydrogenase LpdC (lipoamide reductase (NADH)) (lipoyl dehydrogenase) (dihydrolipoyl dehydrogenase) (diaphorase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 3 to 463 (461 residues), 534.6 bits, E=1e-164
• PF07992: Pyr_redox_2
  • amino acids 4 to 324 (321 residues), 228 bits, E=7.7e-71
• PF01134: GIDA
  • amino acids 5 to 60 (56 residues), 25.9 bits, 2.3e-09
• PF00890: FAD_binding_2
  • amino acids 5 to 34 (30 residues), 23.5 bits, see alignment (E = 1.4e-08)
• PF12831: FAD_oxidored
  • amino acids 5 to 39 (35 residues), 31.3 bits, 6.4e-11
• PF00070: Pyr_redox
  • amino acids 174 to 250 (77 residues), 73 bits, E=1.1e-23
• PF02852: Pyr_redox_dim
  • amino acids 346 to 452 (107 residues), 120.6 bits, E=1.6e-38

Best Hits

Swiss-Prot: 100% identical to DLDH_MYCTU: Dihydrolipoyl dehydrogenase (lpdC) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to mra:MRA_0468)

MetaCyc: 38% identical to dihydrolipoyl dehydrogenase component subunit (Bacillus subtilis)
2-oxoisovalerate dehydrogenase (acylating). [EC: 1.2.1.25, 1.8.1.4]; RXN-7716 [EC: 1.2.1.25, 1.8.1.4, 1.2.1.105]; RXN0-1132 [EC: 1.2.1.25, 1.8.1.4, 1.2.1.105, 1.2.1.104]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• L-valine degradation I (7/8 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• L-isoleucine degradation I (5/6 steps found)
• L-leucine degradation I (5/6 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• pyruvate fermentation to acetate II (2/3 steps found)
• TCA cycle III (animals) (7/10 steps found)
• TCA cycle VIII (Chlamydia) (4/6 steps found)
• L-threonine degradation V (1/2 steps found)
• TCA cycle II (plants and fungi) (6/9 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (2/4 steps found)
• pyruvate fermentation to acetate V (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• superpathway of L-methionine salvage and degradation (10/16 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (17/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (15/26 steps found)
• anteiso-branched-chain fatty acid biosynthesis (18/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (18/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (18/34 steps found)
• L-tryptophan degradation III (eukaryotic) (4/15 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (4/23 steps found)
• superpathway of L-lysine degradation (10/43 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.2.1.104 or 1.2.1.105 or 1.2.1.25 or 1.8.1.4

Protein Sequence (464 amino acids)

>Rv0462 Dihydrolipoamide dehydrogenase LpdC (lipoamide reductase (NADH)) (lipoyl dehydrogenase) (dihydrolipoyl dehydrogenase) (diaphorase) (Mycobacterium tuberculosis H37Rv)
VTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVH
IFTKDAKAFGISGEVTFDYGIAYDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFADANT
LLVDLNDGGTESVTFDNAIIATGSSTRLVPGTSLSANVVTYEEQILSRELPKSIIIAGAG
AIGMEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTATKVESIAD
GGSQVTVTVTKDGVAQELKAEKVLQAIGFAPNVEGYGLDKAGVALTDRKAIGVDDYMRTN
VGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLGDHRMLPRATFCQPNVASFGL
TEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVADAKHGELLGGHLVGHDVAELL
PELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLVGHMINF