Protein Info for Rv0438c in Mycobacterium tuberculosis H37Rv

Annotation: Probable molybdopterin biosynthesis protein MoeA2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 PF03453: MoeA_N" amino acids 3 to 166 (164 residues), 151.5 bits, see alignment E=2.5e-48 TIGR00177: molybdenum cofactor synthesis domain" amino acids 177 to 318 (142 residues), 114.1 bits, see alignment E=2.7e-37 PF00994: MoCF_biosynth" amino acids 180 to 321 (142 residues), 106.2 bits, see alignment E=1.9e-34 PF03454: MoeA_C" amino acids 336 to 404 (69 residues), 57.9 bits, see alignment E=1.4e-19

Best Hits

Swiss-Prot: 100% identical to MOEA2_MYCTO: Molybdopterin molybdenumtransferase 2 (moaE2) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to mbb:BCG_0477c)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>Rv0438c Probable molybdopterin biosynthesis protein MoeA2 (Mycobacterium tuberculosis H37Rv)
VRSVQEHQRVVAEMMRACRPITVPLTQAQGLVLGGDVVAPLSLPVFDNSAMDGYAVRAED
TSGATPQNPVMLPVAEDIPAGRADMLTLQPVTAHRIMTGAPVPTGATAIVPVEATDGGVD
SVAIRQQATPGKHIRRSGEDVAAGTTVLHNGQIVTPAVLGLAAALGLAELPVLPRQRVLV
ISTGSELASPGTPLQPGQIYESNSIMLAAAVRDAGAAVVATATAGDDVAQFGAILDRYAV
DADLIITSGGVSAGAYEVVKDAFGSADYRGGDHGVEFVKVAMQPGMPQGVGRVAGTPIVT
LPGNPVSALVSFEVFIRPPLRMAMGLPDPYRPHRSAVLTASLTSPRGKRQFRRAILDHQA
GTVISYGPPASHHLRWLASANGLLDIPEDVVEVAAGTQLQVWDLT