Protein Info for Rv0435c in Mycobacterium tuberculosis H37Rv

Annotation: Putative conserved ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 728 PF02359: CDC48_N" amino acids 22 to 94 (73 residues), 48.7 bits, see alignment E=2.1e-16 PF00004: AAA" amino acids 250 to 369 (120 residues), 57.9 bits, see alignment E=4.7e-19 amino acids 501 to 631 (131 residues), 133.2 bits, see alignment E=2.4e-42 PF17862: AAA_lid_3" amino acids 391 to 424 (34 residues), 38.4 bits, see alignment (E = 2.1e-13) amino acids 654 to 698 (45 residues), 40.8 bits, see alignment 3.8e-14

Best Hits

KEGG orthology group: K13525, transitional endoplasmic reticulum ATPase (inferred from 100% identity to mtu:Rv0435c)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (728 amino acids)

>Rv0435c Putative conserved ATPase (Mycobacterium tuberculosis H37Rv)
VTHPDPARQLTLTARLNTSAVDSRRGVVRLHPNAIAALGIREWDAVSLTGSRTTAAVAGL
AAADTAVGTVLLDDVTLSNAGLREGTEVIVSPVTVYGARSVTLSGSTLATQSVPPVTLRQ
ALLGKVMTVGDAVSLLPRDLGPGTSTSAASRALAAAVGISWTSELLTVTGVDPDGPVSVQ
PNSLVTWGAGVPAAMGTSTAGQVSISSPEIQIEELKGAQPQAAKLTEWLKLALDEPHLLQ
TLGAGTNLGVLVSGPAGVGKATLVRAVCDGRRLVTLDGPEIGALAAGDRVKAVASAVQAV
RHEGGVLLITDADALLPAAAEPVASLILSELRTAVATAGVVLIATSARPDQLDARLRSPE
LCDRELGLPLPDAATRKSLLEALLNPVPTGDLNLDEIASRTPGFVVADLAALVREAALRA
ASRASADGRPPMLHQDDLLGALTVIRPLSRSASDEVTVGDVTLDDVGDMAAAKQALTEAV
LWPLQHPDTFARLGVEPPRGVLLYGPPGCGKTFVVRALASTGQLSVHAVKGSELMDKWVG
SSEKAVRELFRRARDSAPSLVFLDELDALAPRRGQSFDSGVSDRVVAALLTELDGIDPLR
DVVMLGATNRPDLIDPALLRPGRLERLVFVEPPDAAARREILRTAGKSIPLSSDVDLDEV
AAGLDGYSAADCVALLREAALTAMRRSIDAANVTAADLATARETVRASLDPLQVASLRKF
GTKGDLRS