Protein Info for Rv0427c in Mycobacterium tuberculosis H37Rv

Annotation: Probable exodeoxyribonuclease III protein XthA (exonuclease III) (EXO III) (AP endonuclease VI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR00195: exodeoxyribonuclease III" amino acids 24 to 287 (264 residues), 193.5 bits, see alignment E=5e-61 TIGR00633: exodeoxyribonuclease III (xth)" amino acids 24 to 288 (265 residues), 277.2 bits, see alignment E=1.4e-86 PF03372: Exo_endo_phos" amino acids 27 to 281 (255 residues), 105.1 bits, see alignment E=2.2e-34

Best Hits

KEGG orthology group: K01142, exodeoxyribonuclease III [EC: 3.1.11.2] (inferred from 100% identity to mbt:JTY_0436)

Predicted SEED Role

"Exodeoxyribonuclease III (EC 3.1.11.2)" in subsystem DNA repair, bacterial (EC 3.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.11.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>Rv0427c Probable exodeoxyribonuclease III protein XthA (exonuclease III) (EXO III) (AP endonuclease VI) (Mycobacterium tuberculosis H37Rv)
MPDGTIDGGHPQRPASPRLRSPLLRLATWNVNSIRTRLDRVLDWLGRADVDVLAMQETKC
PDGQFPALPLFELGYDVAHVGFDQWNGVAIASRVGLDDVRVGFDGQPSWSGKPEVAATTE
ARALGATCGGIRVWSLYVPNGRALDDPHYTYKLDWLAALRDTAEGWLRDDPAAPIALMGD
WNIAPTDDDVWSTEFFAGCTHVSEPERKAFNAIVDAQFTDVVRPFTPGPGVYTYWDYTQL
RFPKKQGMRIDFILGSPALAARVMDAQIVREERKGKAPSDHAPVLVDLHAG