Protein Info for Rv0400c in Mycobacterium tuberculosis H37Rv

Annotation: Acyl-CoA dehydrogenase FadE7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF02771: Acyl-CoA_dh_N" amino acids 23 to 135 (113 residues), 107.7 bits, see alignment E=9.3e-35 PF02770: Acyl-CoA_dh_M" amino acids 139 to 229 (91 residues), 88.5 bits, see alignment E=5.6e-29 PF00441: Acyl-CoA_dh_1" amino acids 241 to 386 (146 residues), 102 bits, see alignment E=7.3e-33 PF08028: Acyl-CoA_dh_2" amino acids 257 to 367 (111 residues), 34.5 bits, see alignment E=4.7e-12

Best Hits

Swiss-Prot: 47% identical to GCDH_CAEEL: Probable glutaryl-CoA dehydrogenase, mitochondrial (F54D5.7) from Caenorhabditis elegans

KEGG orthology group: K00252, glutaryl-CoA dehydrogenase [EC: 1.3.99.7] (inferred from 100% identity to mtb:TBMG_00401)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>Rv0400c Acyl-CoA dehydrogenase FadE7 (Mycobacterium tuberculosis H37Rv)
MSTPTPPALDRDDPLGLDASLSSDEIAVRDTVRRFCAEHVTPHVAAWFEDGDLPVARDLA
KQFGELGLLGMQLHGHGCGGASAVHYGLACRELEAADSGIRSLVSVQGSLAMFAIASFGS
DEQKRQWLPGMATGDLLGCFGLTEPDVGSDPAAMKTRARRDGPDWVITGGKMWITNGSVA
DVAIVWAATDDGIRGFIVPTDTPGFTANTIGHKLSLRASITSELVLDNVRLPADAMLPGA
TGLRAPLACLSEARYGIVWGAMGAARSAWQCALDYARQRTQFGRPIAGFQLTQAKLVDMA
VELHKGQLLSLHLGRLKDRVGLRPDQVSFGKLNNTREALKICRTARTILGGNGISLEYPV
IRHMVNLESVLTYEGTPEMHQLVLGQAFTGLAAFR