Protein Info for Rv0384c in Mycobacterium tuberculosis H37Rv

Annotation: Probable endopeptidase ATP binding protein (chain B) ClpB (ClpB protein) (heat shock protein F84.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 848 PF02861: Clp_N" amino acids 6 to 127 (122 residues), 112 bits, see alignment E=1.5e-35 TIGR03346: ATP-dependent chaperone protein ClpB" amino acids 7 to 840 (834 residues), 1290 bits, see alignment E=0 PF23569: NBD_SMAX1" amino acids 185 to 288 (104 residues), 34.9 bits, see alignment E=9.7e-12 PF00004: AAA" amino acids 203 to 317 (115 residues), 45.8 bits, see alignment E=5.6e-15 amino acids 604 to 721 (118 residues), 31.4 bits, see alignment E=1.5e-10 PF17871: AAA_lid_9" amino acids 343 to 445 (103 residues), 121.2 bits, see alignment E=1.1e-38 PF07724: AAA_2" amino acids 598 to 749 (152 residues), 215 bits, see alignment E=4.5e-67 PF00158: Sigma54_activat" amino acids 602 to 703 (102 residues), 23 bits, see alignment E=3.8e-08 PF07728: AAA_5" amino acids 603 to 736 (134 residues), 46.7 bits, see alignment E=2.3e-15 PF10431: ClpB_D2-small" amino acids 756 to 835 (80 residues), 96.4 bits, see alignment E=5.5e-31

Best Hits

Swiss-Prot: 100% identical to CLPB_MYCTO: Chaperone protein ClpB (clpB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03695, ATP-dependent Clp protease ATP-binding subunit ClpB (inferred from 80% identity to asd:AS9A_4076)

MetaCyc: 100% identical to disaggregase ClpB (Mycobacterium tuberculosis H37Rv)
RXN185E-10

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (848 amino acids)

>Rv0384c Probable endopeptidase ATP binding protein (chain B) ClpB (ClpB protein) (heat shock protein F84.1) (Mycobacterium tuberculosis H37Rv)
VDSFNPTTKTQAALTAALQAASTAGNPEIRPAHLLMALLTQNDGIAAPLLEAVGVEPATV
RAETQRLLDRLPQATGASTQPQLSRESLAAITTAQQLATELDDEYVSTEHVMVGLATGDS
DVAKLLTGHGASPQALREAFVKVRGSARVTSPEPEATYQALQKYSTDLTARAREGKLDPV
IGRDNEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVAGDVPESLRDKTIVAL
DLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFIDELHTIVGAGATGEGAMDAGNMI
KPMLARGELRLVGATTLDEYRKHIEKDAALERRFQQVYVGEPSVEDTIGILRGLKDRYEV
HHGVRITDSALVAAATLSDRYITARFLPDKAIDLVDEAASRLRMEIDSRPVEIDEVERLV
RRLEIEEMALSKEEDEASAERLAKLRSELADQKEKLAELTTRWQNEKNAIEIVRDLKEQL
EALRGESERAERDGDLAKAAELRYGRIPEVEKKLDAALPQAQAREQVMLKEEVGPDDIAD
VVSAWTGIPAGRLLEGETAKLLRMEDELGKRVIGQKAAVTAVSDAVRRSRAGVSDPNRPT
GAFMFLGPTGVGKTELAKALADFLFDDERAMVRIDMSEYGEKHTVARLIGAPPGYVGYEA
GGQLTEAVRRRPYTVVLFDEIEKAHPDVFDVLLQVLDEGRLTDGHGRTVDFRNTILILTS
NLGSGGSAEQVLAAVRATFKPEFINRLDDVLIFEGLNPEELVRIVDIQLAQLGKRLAQRR
LQLQVSLPAKRWLAQRGFDPVYGARPLRRLVQQAIGDQLAKMLLAGQVHDGDTVPVNVSP
DADSLILG