Protein Info for Rv0352 in Mycobacterium tuberculosis H37Rv

Annotation: Probable chaperone protein DnaJ1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 TIGR02349: chaperone protein DnaJ" amino acids 10 to 379 (370 residues), 409.3 bits, see alignment E=8.4e-127 PF00226: DnaJ" amino acids 10 to 72 (63 residues), 88.4 bits, see alignment E=3.9e-29 PF01556: DnaJ_C" amino acids 150 to 362 (213 residues), 157.9 bits, see alignment E=3.2e-50 PF00684: DnaJ_CXXCXGXG" amino acids 177 to 237 (61 residues), 54.5 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 100% identical to DNAJ1_MYCTU: Chaperone protein DnaJ 1 (dnaJ1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 100% identity to mbt:JTY_0361)

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>Rv0352 Probable chaperone protein DnaJ1 (Mycobacterium tuberculosis H37Rv)
MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPGNPAAGERFKAVSEAHN
VLSDPAKRKEYDETRRLFAGGGFGGRRFDSGFGGGFGGFGVGGDGAEFNLNDLFDAASRT
GGTTIGDLFGGLFGRGGSARPSRPRRGNDLETETELDFVEAAKGVAMPLRLTSPAPCTNC
HGSGARPGTSPKVCPTCNGSGVINRNQGAFGFSEPCTDCRGSGSIIEHPCEECKGTGVTT
RTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTVHVRPDKIFGRDGDDLTVTV
PVSFTELALGSTLSVPTLDGTVGVRVPKGTADGRILRVRGRGVPKRSGGSGDLLVTVKVA
VPPNLAGAAQEALEAYAAAERSSGFNPRAGWAGNR