Protein Info for Rv0324 in Mycobacterium tuberculosis H37Rv

Annotation: Possible transcriptional regulatory protein (possibly ArsR-family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF01022: HTH_5" amino acids 26 to 69 (44 residues), 27.9 bits, see alignment 2.5e-10 PF09339: HTH_IclR" amino acids 28 to 70 (43 residues), 26.9 bits, see alignment 4.9e-10 PF00581: Rhodanese" amino acids 121 to 210 (90 residues), 72.6 bits, see alignment E=4.8e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_0334)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>Rv0324 Possible transcriptional regulatory protein (possibly ArsR-family) (Mycobacterium tuberculosis H37Rv)
MAGQSDRKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIATATGMNLTTASANLQ
ALKSGGLVEARREGTRQYYRIAGEDVARLFALVQVVADEHLADVAVAAADVLGSPEDAIT
RAELLRRREAGEVTLVDVRPHEEYQAGHIPGAINIPIAELADRLAELTGDRDIVAYCRGA
YCVMAPDAVRIARDAGREVKRLDDGMLEWRLAGLPVDEGAPVGHGD