Protein Info for Rv0282 in Mycobacterium tuberculosis H37Rv

Annotation: ESX conserved component EccA3. ESX-3 type VII secretion system protein.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 PF21545: T7SS_EccA1_N" amino acids 43 to 316 (274 residues), 301.2 bits, see alignment E=1.7e-93 TIGR03922: type VII secretion AAA-ATPase EccA" amino acids 68 to 623 (556 residues), 841.8 bits, see alignment E=1.2e-257 PF01078: Mg_chelatase" amino acids 370 to 406 (37 residues), 22.2 bits, see alignment 2.1e-08 PF00004: AAA" amino acids 382 to 513 (132 residues), 67.4 bits, see alignment E=4.5e-22 PF17866: AAA_lid_6" amino acids 568 to 614 (47 residues), 38.3 bits, see alignment 2.8e-13

Best Hits

Swiss-Prot: 100% identical to ECCA3_MYCTU: ESX-3 secretion system protein EccA3 (eccA3) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv0282)

Predicted SEED Role

"AAA+ family protein ATPase EccA1, component of Type VII secretion system ESX-1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (631 amino acids)

>Rv0282 ESX conserved component EccA3. ESX-3 type VII secretion system protein. (Mycobacterium tuberculosis H37Rv)
MAGVGEGDSGGVERDDIGMVAASPVASRVNGKVDADVVGRFATCCRALGIAVYQRKRPPD
LAAARSGFAALTRVAHDQCDAWTGLAAAGDQSIGVLEAASRTATTAGVLQRQVELADNAL
GFLYDTGLYLRFRATGPDDFHLAYAAALASTGGPEEFAKANHVVSGITERRAGWRAARWL
AVVINYRAERWSDVVKLLTPMVNDPDLDEAFSHAAKITLGTALARLGMFAPALSYLEEPD
GPVAVAAVDGALAKALVLRAHVDEESASEVLQDLYAAHPENEQVEQALSDTSFGIVTTTA
GRIEARTDPWDPATEPGAEDFVDPAAHERKAALLHEAELQLAEFIGLDEVKRQVSRLKSS
VAMELVRKQRGLTVAQRTHHLVFAGPPGTGKTTIARVVAKIYCGLGLLKRENIREVHRAD
LIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDR
LVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPSYTSHELVEIAHKMAEQRDSVFEQSAL
HDLEALFAKLAAESTPDTNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDHSEHAGSGE
FSDEELMTITADDVGRSVEPLLRGLGLSVRA