Protein Info for Rv0267 in Mycobacterium tuberculosis H37Rv

Annotation: Probable integral membrane nitrite extrusion protein NarU (nitrite facilitator)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 47 to 69 (23 residues), see Phobius details amino acids 84 to 109 (26 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 399 to 421 (23 residues), see Phobius details amino acids 433 to 452 (20 residues), see Phobius details TIGR00886: nitrite transporter" amino acids 45 to 412 (368 residues), 348.5 bits, see alignment E=2.3e-108 PF07690: MFS_1" amino acids 57 to 384 (328 residues), 64.5 bits, see alignment E=4.3e-22

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 100% identity to mtb:TBMG_00269)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>Rv0267 Probable integral membrane nitrite extrusion protein NarU (nitrite facilitator) (Mycobacterium tuberculosis H37Rv)
MALTTAPAIDYALPRQQDEGDHWIDDWRPEDPVFWETIGRPIARRNLIFSIFAEHVGFSV
WMLWSIVVVQMTAAAPGHPAASGWALSASQALCLVAVPSGVGAFLRLPYTFAIPIFGGRN
WTTVSAALLVIPCLLLAWAVSHPSLPFAVLVVIAATAGFGGGNFASSMANISFFYPEKDK
GWALGLNAAGGNIGVAVVQKIIPPIVVAGSGVALSRAGLFFVPLAVAAAVCAFLFMNNLT
EAKADVKPVWQSLRHADTWIMSLLYIGTFGSFIGYSAAFPTLLKTVFGRGDIALGWAFLG
AGIGSLVRPLGGKLADRIGGARITAASFVMLAAGAAAALWSVQSVNLPVFFVSFMFLFVA
TGIGNGSSYRMISRIFQVKGEVAGGDPETMVNMRRQAAGALGIISSIGAFGGFVVPLAYA
WSKVHFGNIEPALHFYVAFFLALLVVTWYCYLRRTTPMGQVGV