Protein Info for Rv0261c in Mycobacterium tuberculosis H37Rv

Annotation: Probable integral membrane nitrite extrusion protein NarK3 (nitrite facilitator)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 30 to 55 (26 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 392 to 413 (22 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 406 (367 residues), 55.6 bits, see alignment E=2.2e-19

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 100% identity to mtf:TBFG_10265)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>Rv0261c Probable integral membrane nitrite extrusion protein NarK3 (nitrite facilitator) (Mycobacterium tuberculosis H37Rv)
MGRSHQISDWDPEDSVAWEAGNKFIARRNLIWSVAAEHVGFSVWSLWSVMVLFMPTSVYG
FSAGDKFLLGATATLVGACLRFPYTFATAKFGGRNWTIFSALVLLIPTVGSILLLANPGL
PLWPYLVCGALAGLGGGNFAASMTNINAFFPQRLKGAALALNAGGGNLGVPMVQLVGLLV
IATAGDREPYWVCAIYLVLLAVAGLGAALYMDNLTEYRIELNTMRAVVSEPHTWVISLLY
IGTFGSFIGFSFAFGQVLQINFIASGQSTAQASLHAAQIAFLGPLLGSLSRIYGGKLADR
IGGGRVTLAAFCAMLLATGILISASTFGDHLAGPMPTATMVGYVIGFTALFILSGIGNGS
VYKMIPSIFEARSHSLQISEAERRQWSRSMSGALIGLAGAVGALGGVGVNLALRESYLTS
GTATSAFWAFGVFYLVASVLTWAIYVRRGLKSAGELVPATTAPAGLAYV