Protein Info for Rv0255c in Mycobacterium tuberculosis H37Rv

Annotation: Probable cobyric acid synthase CobQ1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF13500: AAA_26" amino acids 3 to 233 (231 residues), 61.3 bits, see alignment E=1.9e-20 TIGR00313: cobyric acid synthase CobQ" amino acids 4 to 473 (470 residues), 424.9 bits, see alignment E=2.2e-131 PF01656: CbiA" amino acids 5 to 234 (230 residues), 85.6 bits, see alignment E=4.1e-28 PF07685: GATase_3" amino acids 255 to 429 (175 residues), 149.1 bits, see alignment E=1.9e-47

Best Hits

Swiss-Prot: 100% identical to COBQ_MYCBO: Cobyric acid synthase (cobQ) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K02232, adenosylcobyric acid synthase [EC: 6.3.5.10] (inferred from 100% identity to mbo:Mb0261c)

Predicted SEED Role

"Cobyric acid synthase (EC 6.3.5.10)" (EC 6.3.5.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>Rv0255c Probable cobyric acid synthase CobQ1 (Mycobacterium tuberculosis H37Rv)
MSGLLVAGTTSDAGKSAVTAGLCRALARRGVRVAPFKAQNMSNNSMVCRGPDGTGVEIGR
AQWVQALAARTTPEAAMNPVLLKPASDHRSHVVLMGKPWGEVASSSWCAGRRALAEAACR
AFDALAARYDVVVAEGAGSPAEINLRAGDYVNMGLARHAGLPTIVVGDIDRGGVFAAFLG
TVALLAAEDQALVAGFVVNKFRGDSDLLAPGLRDLERVTGRRVYGTLPWHPDLWLDSEDA
LDLQGRRAAGTGARRVAVVRLPRISNFTDVDALGLEPDLDVVFASDPRALDDADLIVLPG
TRATIADLAWLRARDLDRALLVHVAAGKPLLGICGGFQMLGRVIRDPYGIEGPGGQVTEV
EGLGLLDVETAFSPHKVLRLPRGEGLGVPASGYEIHHGRITRGDTAEEFLGGARDGPVFG
TMWHGSLEGDALREAFLRETLGLAPSGSCFLAARERRLDLLGDLVERHLDVDALLNLARH
GCPPTLPFLAPGAP