Protein Info for Rv0247c in Mycobacterium tuberculosis H37Rv

Annotation: Probable succinate dehydrogenase [iron-sulfur subunit] (succinic dehydrogenase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF13085: Fer2_3" amino acids 8 to 105 (98 residues), 87.2 bits, see alignment E=1.1e-28 TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein" amino acids 17 to 219 (203 residues), 145.6 bits, see alignment E=7.9e-47 PF00111: Fer2" amino acids 21 to 69 (49 residues), 21.3 bits, see alignment 3.2e-08 PF13183: Fer4_8" amino acids 141 to 216 (76 residues), 36 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: K00240, succinate dehydrogenase iron-sulfur protein [EC: 1.3.99.1] (inferred from 100% identity to mtu:Rv0247c)

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>Rv0247c Probable succinate dehydrogenase [iron-sulfur subunit] (succinic dehydrogenase) (Mycobacterium tuberculosis H37Rv)
MTYSASMRVWRGDESCGELREFTVEVNEGEVVLDVILRLQQTQTPDLAVRWNCKAGKCGS
CSAEINGKPRLMCMTRMSTFDEDEIVTVTPMRTFPVIRDLVTDVSFNYQKAREIPSFAPP
KELQPSEYRMAQVDVARSQEFRKCIECFLCQNVCHVVRDHEENKDAFAGPRFLMRIAELE
MHPLDTRDRRSQAQEEHGLGYCNITKCCTEVCPENIKITDNALIPMKERVADRKYDPVVW
LGSKLFRR