Protein Info for Rv0212c in Mycobacterium tuberculosis H37Rv

Annotation: Possible transcriptional regulatory protein NadR (probably AsnC-family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR01526: nicotinamide-nucleotide adenylyltransferase" amino acids 2 to 307 (306 residues), 439.7 bits, see alignment E=6.8e-136 TIGR00125: cytidyltransferase-like domain" amino acids 4 to 65 (62 residues), 45.6 bits, see alignment E=6.2e-16 PF01467: CTP_transf_like" amino acids 6 to 100 (95 residues), 21 bits, see alignment E=3.3e-08 PF13521: AAA_28" amino acids 154 to 307 (154 residues), 119.3 bits, see alignment E=2e-38

Best Hits

KEGG orthology group: None (inferred from 99% identity to mtc:MT0222)

Predicted SEED Role

"Nicotinamide-nucleotide adenylyltransferase, NadR family (EC 2.7.7.1) / Ribosylnicotinamide kinase (EC 2.7.1.22)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters (EC 2.7.1.22, EC 2.7.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.22 or 2.7.7.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>Rv0212c Possible transcriptional regulatory protein NadR (probably AsnC-family) (Mycobacterium tuberculosis H37Rv)
VTHGMVLGKFMPPHAGHVYLCEFARRWVDELTIVVGSTAAEPIPGAQRVAWMRELFPFDR
VVHLANENPQRPWEHPDFWDIWKASLQGVLATRPDFVFGAEPYNADFAQVLGARFVAVDH
GRTVVPVTATDIRADPLGHWQHIPRCVRPAFVKRVSIIGPESTGKTTLAQAVAEKLRTKW
VPERAKMLRELNGGSLIGLEWAEIVRGQIASEEALARDADRVLICDTDPLATTVWAEFLA
GGCPQELRDLARRPYDLTLLTTPDVPWDADDGRCVPGARGTFFARCEQALRAAGRSFVVI
TGGWEERLSVSLRAVEELVRARR