Protein Info for Rv0208c in Mycobacterium tuberculosis H37Rv

Annotation: Hypothetical methlytransferase (methylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR00091: tRNA (guanine-N(7)-)-methyltransferase" amino acids 72 to 243 (172 residues), 116.4 bits, see alignment E=5.3e-38 PF02390: Methyltransf_4" amino acids 76 to 247 (172 residues), 187.8 bits, see alignment E=5.9e-60

Best Hits

Swiss-Prot: 100% identical to TRMB_MYCTU: tRNA (guanine-N(7)-)-methyltransferase (trmB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03439, tRNA (guanine-N7-)-methyltransferase [EC: 2.1.1.33] (inferred from 100% identity to mbo:Mb0214c)

Predicted SEED Role

"tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33)" (EC 2.1.1.33)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>Rv0208c Hypothetical methlytransferase (methylase) (Mycobacterium tuberculosis H37Rv)
MVHHGQMHAQPGVGLRPDTPVASGQLPSTSIRSRRSGISKAQRETWERLWPELGLLALPQ
SPRGTPVDTRAWFGRDAPVVLEIGSGSGTSTLAMAKAEPHVDVIAVDVYRRGLAQLLCAI
DKVGSDGINIRLILGNAVDVLQHLIAPDSLCGVRVFFPDPWPKARHHKRRLLQPATMALI
ADRLVPSGVLHAATDHPGYAEHIAAAGDAEPRLVRVDPDTELLPISVVRPATKYERKAQL
GGGAVIELLWKKHGCSERDLKIR