Protein Info for Rv0205 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 73 to 99 (27 residues), see Phobius details amino acids 156 to 181 (26 residues), see Phobius details amino acids 214 to 243 (30 residues), see Phobius details amino acids 245 to 273 (29 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 310 to 338 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 22 to 347 (326 residues), 276.4 bits, see alignment E=1.6e-86

Best Hits

Swiss-Prot: 100% identical to Y205_MYCTU: Putative transport protein Rv0205 (Rv0205) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_0242)

Predicted SEED Role

"FIG01121868: Possible membrane protein, Rv0205"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>Rv0205 Probable conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MSASLDDASVAPLVRKTAAWAWRFLVILAAMVALLWVLNKFEVIVVPVLLALMLSALLVP
PVDWLDSRGLPHAVAVTLVLLSGFAVLGGILTFVVSQFIAGLPHLVTEVERSIDSARRWL
IEGPAHLRGEQIDNAGNAAIEALRNNQAKLTSGALSTAATITELVTAAVLVLFTLIFFLY
GGRSIWQYVTKAFPASVRDRVRAAGRAGYASLIGYARATFLVALTDAAGVGAGLAVMGVP
LALPLASLVFFGAFIPLIGAVVAGFLAVVVALLAKGIGYALITVGLLIAVNQLEAHLLQP
LVMGRAVSIHPLAVVLAIAAGGVLAGVVGALLAVPTVAFFNNAVQVLLGGNPFADVADVS
SDHLTEV