Protein Info for Rv0182c in Mycobacterium tuberculosis H37Rv

Annotation: Probable alternative RNA polymerase sigma factor SigG (RNA polymerase ECF type sigma factor)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02960: RNA polymerase sigma-70 factor, TIGR02960 family" amino acids 55 to 366 (312 residues), 466.1 bits, see alignment E=5.8e-144 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 61 to 234 (174 residues), 84.7 bits, see alignment E=5.6e-28 PF04542: Sigma70_r2" amino acids 64 to 129 (66 residues), 72.3 bits, see alignment E=5.6e-24 PF08281: Sigma70_r4_2" amino acids 180 to 232 (53 residues), 51.8 bits, see alignment 1.3e-17 PF04545: Sigma70_r4" amino acids 185 to 233 (49 residues), 28.3 bits, see alignment 2.5e-10 PF13577: SnoaL_4" amino acids 249 to 307 (59 residues), 26 bits, see alignment E=1.9e-09 PF12680: SnoaL_2" amino acids 256 to 331 (76 residues), 35 bits, see alignment E=4.7e-12

Best Hits

Swiss-Prot: 100% identical to SIGG_MYCTO: ECF RNA polymerase sigma factor SigG (sigG) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to mtb:TBMG_00183)

Predicted SEED Role

"RNA polymerase factor sigma-70"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>Rv0182c Probable alternative RNA polymerase sigma factor SigG (RNA polymerase ECF type sigma factor) (Mycobacterium tuberculosis H37Rv)
MRTSPMPAKFRSVRVVVITGSVTAAPVRVSETLRRLIDVSVLAENSGREPADERRGDFSA
HTEPYRRELLAHCYRMTGSLHDAEDLVQETLLRAWKAYEGFAGKSSLRTWLHRIATNTCL
TALEGRRRRPLPTGLGRPSADPSGELVERREVSWLEPLPDVTDDPADPSTIVGNRESVRL
AFVAALQHLSPRQRAVLLLRDVLQWKSAEVADAIGTSTVAVNSLLQRARSQLQTVRPSAA
DRLSAPDSPEAQDLLARYIAAFEAYDIDRLVELFTAEAIWEMPPYTGWYQGAQAIVTLIH
QQCPAYSPGDMRLISLIANGQPAAAMYMRAGDVHLPFQLHVLDMAADRVSHVVAFLDTTL
FPKFGLPDSL