Protein Info for Rv0176 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved Mce associated transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 164 to 188 (25 residues), see Phobius details PF06271: RDD" amino acids 21 to 144 (124 residues), 54.1 bits, see alignment E=1.1e-18

Best Hits

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_0182)

Predicted SEED Role

"FIG033285: Conserved MCE associated transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>Rv0176 Probable conserved Mce associated transmembrane protein (Mycobacterium tuberculosis H37Rv)
VTVVVEKTPTTLPQATPNGAAPWHVRAGAFAIDVLPGLAVAATMALTALTVPPGSAWRWL
CACLLGLTILLLAVNRLLLPTITGWSLGRALTGIRVVRRDGSAIGPWRLLVRDLAHLVDT
LSLFVGWLWPLWDSRRRTFADLLLRTEVRRVEPVQRPAVIRRLTAAVALAAAGACASATA
VGAAVVYVNEWQTDHTRAQLATRGPKLVVDVLSYDPETVQRDFERARSLATDRYRPQLSI
QQDSVRESGPVRNQYWVTDSAVLSATPAQATMLLFMQGERGTPPNQRYIQSTVRAIFQKS
RGQWRLDDLAVVMKPRQPTGEK