Protein Info for Rv0171 in Mycobacterium tuberculosis H37Rv

Annotation: Mce-family protein Mce1C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR00996: virulence factor Mce family protein" amino acids 11 to 292 (282 residues), 281.2 bits, see alignment E=4.3e-88 PF02470: MlaD" amino acids 39 to 112 (74 residues), 53.9 bits, see alignment E=1.7e-18 PF11887: Mce4_CUP1" amino acids 116 to 290 (175 residues), 49.7 bits, see alignment E=3.8e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbo:Mb0177)

Predicted SEED Role

"MCE family protein of Mce C Subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>Rv0171 Mce-family protein Mce1C (Mycobacterium tuberculosis H37Rv)
MRTLEPPNRMRIGLMGIVVALLVVAVGQSFTSVPMLFAKPSYYGQFTDSGGLHKGDRVRI
AGLGVGTVEGLKIDGDHIVVKFSIGTNTIGTESRLAIRTDTILGRKVLEIEPRGAQALPP
GGVLPVGQSTTPYQIYDAFFDVTKAASGWDIETVKRSLNVLSETVDQTYPHLSAALDGVA
KFSDTIGKRDEQITHLLAQANQVASILGDRSEQVDRLLVNAKTLIAAFNERGRAVDALLG
NISAFSAQVQNLINDNPNLNHVLEQLRILTDLLVDRKEDLAETLTILGRFSASFGETFAS
GPYFKVLLANLVPGQILQPFVDAAFKKRGISPEDFWRSAGLPAYRWPDPNGTRFPNGAPP
PPPPVLEGTPEHPGPAVPPGSPCSYTPPADGLPRPWDPLPCANLTQGPFGGPDFPAPLDV
ATSPPNPDGPPPAPGLPIAGRPGEVPPNVPGTPVPIPQEAPPGARTLPLGPAPGPAPPPA
APGPPAPPGPGPQLPAPFINPGGTGGSGVTGGSEN