Protein Info for Rv0149 in Mycobacterium tuberculosis H37Rv

Annotation: Possible quinone oxidoreductase (NADPH:quinone oxidoreductase) (zeta-crystallin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 233 to 243 (11 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details PF08240: ADH_N" amino acids 28 to 86 (59 residues), 35.3 bits, see alignment E=1.3e-12 PF00107: ADH_zinc_N" amino acids 150 to 272 (123 residues), 98.7 bits, see alignment E=4e-32 PF13602: ADH_zinc_N_2" amino acids 183 to 320 (138 residues), 48.1 bits, see alignment E=3.7e-16

Best Hits

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 100% identity to mtc:MT0157)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>Rv0149 Possible quinone oxidoreductase (NADPH:quinone oxidoreductase) (zeta-crystallin) (Mycobacterium tuberculosis H37Rv)
MKACVVKELSGPSGMVYTDIDEVSGDGGKVVIDVRAAGVCFPDLLLTKGEYQLKLTPPFV
PGMETAGVVRSAPSDAGFHVGERVSAFGVLGGYAEQIAVPVANVVRSPVELDDAGAVSLL
VNYNTMYFALARRAALRPGDTVLVLGAAGGVGTAAVQIAKAMQAGKVIAMVHREGAIDYV
ASLGADVVLPLTEGWAQQVRDHTYGQGVDIVVDPIGGPTFDDALGVLAIDGKLLLIGFAA
GAVPTLKVNRLLVRNISVVGVGWGEYLNAVPGSAALFAWGLNQLVFLGLRPPPPQRYPLS
EAQAALQSLDDGGVLGKVVLEP