Protein Info for Rv0131c in Mycobacterium tuberculosis H37Rv

Annotation: Probable acyl-CoA dehydrogenase FadE1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF02771: Acyl-CoA_dh_N" amino acids 27 to 141 (115 residues), 51.6 bits, see alignment E=2.2e-17 PF02770: Acyl-CoA_dh_M" amino acids 145 to 232 (88 residues), 79 bits, see alignment E=4.8e-26 PF00441: Acyl-CoA_dh_1" amino acids 261 to 409 (149 residues), 106 bits, see alignment E=4.1e-34 PF08028: Acyl-CoA_dh_2" amino acids 275 to 380 (106 residues), 33.8 bits, see alignment E=7.9e-12

Best Hits

KEGG orthology group: K00249, acyl-CoA dehydrogenase [EC: 1.3.99.3] (inferred from 100% identity to mtc:MT0139)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.3

Use Curated BLAST to search for 1.3.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>Rv0131c Probable acyl-CoA dehydrogenase FadE1 (Mycobacterium tuberculosis H37Rv)
MPVRRRAGERLPTVWDFETDPQYQSKLDWVEKFMAEELEPLDLVALDPYDKKNADTMAIL
RPLQRQVKDQGLWAAHLRPELGGQGFGQVKLALLNEIIGRSRWAPSAFGCQAPDSGNAEI
LALFGTDEQKARYLRPLLDGEITSCYSMTEPQGGSDPGLFVTAATRDAAGNGDWIINGEK
WFSTNAKHASFFIVMAVTKPEARTYEKMSLFIVPADTPGIEIVRNVGVGAESTRHASHGY
IRYHDVRVPADHVLGGEGQAFMIAQTRLGGGRIHHAMRTIALARRAFDMMCERALSRQTR
HGRLADLQMTQEKIADSWIQIEQFRLLVLRTAWLIDKHHDYQKVRRDIAAVKVAMPQVLH
DVVQRAMHLHGALGVSDEMPFVKMMLAAESLGIADGATELHKMTVARRTLREYQPVTTLF
PSQHIPTRRAHAEAWLAQRLEHAIAEF