Protein Info for Rv0087 in Mycobacterium tuberculosis H37Rv

Annotation: Possible formate hydrogenase HycE (FHL)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 PF00329: Complex1_30kDa" amino acids 11 to 120 (110 residues), 61.1 bits, see alignment E=2.4e-20 PF00374: NiFeSe_Hases" amino acids 181 to 247 (67 residues), 32.8 bits, see alignment E=5.7e-12 PF00346: Complex1_49kDa" amino acids 256 to 411 (156 residues), 65.1 bits, see alignment E=8.6e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_0091)

Predicted SEED Role

"Formate hydrogenlyase subunit 5" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (492 amino acids)

>Rv0087 Possible formate hydrogenase HycE (FHL) (Mycobacterium tuberculosis H37Rv)
VMSASWLRHRVSERGLIATAEQLWADSFRLALVAAHDDGDSLRVVYLFLAGYPDRRVELE
YVVPADNPEIRSLAYLSFPAGRFEREMADLYGIRPVGHPKPRRLVRHAHWPDWHPMRTDA
GPAPEFTDTGAFPFLAVEGPGVYEIPVGPVHAGLIEPGHFRFSVAGETIVRLKARLWFVH
RGIEKLFHGRPATAAVDLAERISGDTSAAHALAHSLAIEDALGIELPHEVHRLRALIVEL
ERLYNHAADLGALANDVGYSLANAHAQRIRENLLRRNAAVTGHRLLRGAIRAGGVALRAL
PDTDELAALAVDLAEVATLTLANSVVYDRFAGTAVLHPDDASALGCLGYVARASGLRSDA
RVEHPTIVLPITEIGAPDGDVLARYTVRRDEFAASAALAQHIVESHTGPIEYAATLHPVG
APSSGIGIVEGWRGTIVHRVEIDVDGRITRAKVVDPSWFNWPALPVAMADTIVPDFPLAN
KSFNQSYAGNDL