Protein Info for Rv0072 in Mycobacterium tuberculosis H37Rv

Annotation: Probable glutamine-transport transmembrane protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details amino acids 274 to 300 (27 residues), see Phobius details amino acids 306 to 330 (25 residues), see Phobius details PF12704: MacB_PCD" amino acids 18 to 185 (168 residues), 42.3 bits, see alignment E=1e-14 PF02687: FtsX" amino acids 233 to 341 (109 residues), 52 bits, see alignment E=7.1e-18

Best Hits

Swiss-Prot: 100% identical to Y072_MYCTO: Uncharacterized ABC transporter permease MT0078 (MT0078) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K02004, (no description) (inferred from 100% identity to mbb:BCG_0103)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>Rv0072 Probable glutamine-transport transmembrane protein ABC transporter (Mycobacterium tuberculosis H37Rv)
MLFAALRDMQWRKRRLVITIISTGLIFGMTLVLTGLANGFRVEARHTVDSMGVDVFVVRS
GAAGPFLGSIPFPDVDLARVAAEPGVMAAAPLGSVGTIMKEGTSTRNVTVFGAPEHGPGM
PRVSEGRSPSKPDEVAASSTMGRHLGDTVEVGARRLRVVGIVPNSTALAKIPNVFLTTEG
LQKLAYNGQPNITSIGIIGMPRQLPEGYQTFDRVGAVNDLVRPLKVAVNSISIVAVLLWI
VAVLIVGSVVYLSALERLRDFAVFKAIGTPTRSIMAGLALQALVIALLAAVVGVVLAQVL
APLFPMIVAVPVGAYLALPVAAIVIGLFASVAGLKRVVTVDPAQAFGGP