Protein Info for Rv0069c in Mycobacterium tuberculosis H37Rv

Annotation: Probable L-serine dehydratase SdaA (L-serine deaminase) (SDH) (L-SD)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00720: L-serine ammonia-lyase
  • amino acids 3 to 454 (452 residues), 695.4 bits, E=1.7e-213
• PF03315: SDH_beta
  • amino acids 4 to 156 (153 residues), 186.7 bits, E=3.7e-59
• PF03313: SDH_alpha
  • amino acids 187 to 451 (265 residues), 292.1 bits, E=4.5e-91

Best Hits

Swiss-Prot: 100% identical to SDHL_MYCBO: L-serine dehydratase (sdaA) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 100% identity to mtu:Rv0069c)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• D-serine degradation (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• glycine degradation (2/3 steps found)
• glycine betaine degradation III (4/7 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (2/8 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Protein Sequence (461 amino acids)

>Rv0069c Probable L-serine dehydratase SdaA (L-serine deaminase) (SDH) (L-SD) (Mycobacterium tuberculosis H37Rv)
MTISVFDLFTIGIGPSSSHTVGPMRAANQFVVALRRRGHLDDLEAMRVDLFGSLAATGAG
HGTMSAILLGLEGCQPETITTEHKERRLAEIAASGVTRIGGVIPVPLTERDIDLHPDIVL
PTHPNGMTFTAAGPHGRVLATETYFSVGGGFIVTEQTSGNSGQHPCSVALPYVSAQELLD
ICDRLDVSISEAALRNETCCRTENEVRAALLHLRDVMVECEQRSIAREGLLPGGLRVRRR
AKVWYDRLNAEDPTRKPEFAEDWVNLVALAVNEENASGGRVVTAPTNGAAGIVPAVLHYA
IHYTSAGAGDPDDVTVRFLLTAGAIGSLFKERASISGAEVGCQGEVGSAAAMAAAGLAEI
LGGTPRQVENAAEIAMEHSLGLTCDPIAGLVQIPCIERNAISAGKAINAARMALRGDGIH
RVTLDQVIDTMRATGADMHTKYKETSAGGLAINVAVNIVEC