Protein Info for Rv0056 in Mycobacterium tuberculosis H37Rv

Annotation: 50S ribosomal protein L9 RplI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF01281: Ribosomal_L9_N" amino acids 1 to 46 (46 residues), 71.7 bits, see alignment E=2.9e-24 TIGR00158: ribosomal protein bL9" amino acids 1 to 150 (150 residues), 117.8 bits, see alignment E=2.8e-38 PF03948: Ribosomal_L9_C" amino acids 63 to 150 (88 residues), 82.1 bits, see alignment E=3.2e-27

Best Hits

Swiss-Prot: 100% identical to RL9_MYCTA: 50S ribosomal protein L9 (rplI) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K02939, large subunit ribosomal protein L9 (inferred from 100% identity to mbt:JTY_0057)

Predicted SEED Role

"LSU ribosomal protein L9p" in subsystem CBSS-262719.3.peg.410 or Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>Rv0056 50S ribosomal protein L9 RplI (Mycobacterium tuberculosis H37Rv)
MKLILTADVDHLGSIGDTVEVKDGYGRNFLLPRGLAIVASRGAQKQADEIRRARETKSVR
DLEHANEIKAAIEALGPIALPVKTSADSGKLFGSVTAADVVAAIKKAGGPNLDKRIVRLP
KTHIKAVGTHFVSVHLHPEIDVEVSLDVVAQS