Protein Info for Rv0038 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF02622: DUF179" amino acids 31 to 184 (154 residues), 117 bits, see alignment E=4.1e-38

Best Hits

Swiss-Prot: 100% identical to Y069_MYCBP: UPF0301 protein BCG_0069 (BCG_0069) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K07735, putative transcriptional regulator (inferred from 100% identity to mtc:MT0043)

Predicted SEED Role

"FIG00996838: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>Rv0038 Conserved protein (Mycobacterium tuberculosis H37Rv)
VVAPHEDPEDHVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNDGGTLGVVLNRPS
ETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRVGADPEGVPGLRHVAGRLVMV
DLDADPEVLAAAVEGVRIYAGYSGWTIGQLEGEIERDDWIVLSALPSDVLVGPRADLWGQ
VLRRQPLPLSLLATHPIDLSRN