Protein Info for Rv0020c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein with FHA domain, FhaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 PF12401: FhaA_N" amino acids 9 to 121 (113 residues), 119.3 bits, see alignment E=1.8e-38 PF16697: Yop-YscD_cpl" amino acids 444 to 523 (80 residues), 47.3 bits, see alignment E=3e-16 PF00498: FHA" amino acids 456 to 518 (63 residues), 67.6 bits, see alignment E=1.6e-22

Best Hits

Swiss-Prot: 100% identical to FHAA_MYCTU: FHA domain-containing protein FhaA (fhaA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_0022)

Predicted SEED Role

"FIG025441: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>Rv0020c Conserved protein with FHA domain, FhaA (Mycobacterium tuberculosis H37Rv)
MGSQKRLVQRVERKLEQTVGDAFARIFGGSIVPQEVEALLRREAADGIQSLQGNRLLAPN
EYIITLGVHDFEKLGADPELKSTGFARDLADYIQEQGWQTYGDVVVRFEQSSNLHTGQFR
ARGTVNPDVETHPPVIDCARPQSNHAFGAEPGVAPMSDNSSYRGGQGQGRPDEYYDDRYA
RPQEDPRGGPDPQGGSDPRGGYPPETGGYPPQPGYPRPRHPDQGDYPEQIGYPDQGGYPE
QRGYPEQRGYPDQRGYQDQGRGYPDQGQGGYPPPYEQRPPVSPGPAAGYGAPGYDQGYRQ
SGGYGPSPGGGQPGYGGYGEYGRGPARHEEGSYVPSGPPGPPEQRPAYPDQGGYDQGYQQ
GATTYGRQDYGGGADYTRYTESPRVPGYAPQGGGYAEPAGRDYDYGQSGAPDYGQPAPGG
YSGYGQGGYGSAGTSVTLQLDDGSGRTYQLREGSNIIGRGQDAQFRLPDTGVSRRHLEIR
WDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRLGHSEIIVRMH