Protein Info for Rv0016c in Mycobacterium tuberculosis H37Rv

Annotation: Probable penicillin-binding protein PbpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF21922: PBP_dimer_2" amino acids 52 to 134 (83 residues), 99.7 bits, see alignment E=9.1e-33 PF00905: Transpeptidase" amino acids 160 to 484 (325 residues), 226.4 bits, see alignment E=4.8e-71

Best Hits

Swiss-Prot: 100% identical to PBPA_MYCTU: Penicillin-binding protein A (pbpA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K05364, peptidoglycan glycosyltransferase [EC: 2.4.1.129] (inferred from 100% identity to mra:MRA_0018)

Predicted SEED Role

"Cell division protein FtsI [Peptidoglycan synthetase] (EC 2.4.1.129)" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Flagellum in Campylobacter or Peptidoglycan Biosynthesis (EC 2.4.1.129)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129

Use Curated BLAST to search for 2.4.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>Rv0016c Probable penicillin-binding protein PbpA (Mycobacterium tuberculosis H37Rv)
MNASLRRISVTVMALIVLLLLNATMTQVFTADGLRADPRNQRVLLDEYSRQRGQITAGGQ
LLAYSVATDGRFRFLRVYPNPEVYAPVTGFYSLRYSSTALERAEDPILNGSDRRLFGRRL
ADFFTGRDPRGGNVDTTINPRIQQAGWDAMQQGCYGPCKGAVVALEPSTGKILALVSSPS
YDPNLLASHNPEVQAQAWQRLGDNPASPLTNRAISETYPPGSTFKVITTAAALAAGATET
EQLTAAPTIPLPGSTAQLENYGGAPCGDEPTVSLREAFVKSCNTAFVQLGIRTGADALRS
MARAFGLDSPPRPTPLQVAESTVGPIPDSAALGMTSIGQKDVALTPLANAEIAATIANGG
ITMRPYLVGSLKGPDLANISTTVGYQQRRAVSPQVAAKLTELMVGAEKVAQQKGAIPGVQ
IASKTGTAEHGTDPRHTPPHAWYIAFAPAQAPKVAVAVLVENGADRLSATGGALAAPIGR
AVIEAALQGEP