Protein Info for RS_RS24180 in Ralstonia solanacearum GMI1000

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 295 to 318 (24 residues), see Phobius details amino acids 348 to 374 (27 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 31 to 255 (225 residues), 76.6 bits, see alignment E=3.3e-25 PF02687: FtsX" amino acids 299 to 412 (114 residues), 69.6 bits, see alignment E=2.4e-23

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to rso:RS03079)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XQ21 at UniProt or InterPro

Protein Sequence (420 amino acids)

>RS_RS24180 ABC transporter permease (Ralstonia solanacearum GMI1000)
MDKRLQHQVQRLRIAVGFAWQSILTNRRRIALAVAGVAIGIAAVTSMLVIGDSVTAQATR
ALDQLGADVVTISVPPPGADPSGQSAEPLSEAAQARLDATTDAAVAALRHMPEVQSVARL
ERRFGCGDGPETALGSPDIVAANPDLPGVLSLRLQRGRFLSPLDARQPWIVLGADIAAEL
RKTRLDVQPGAALPLCGKTFFLAGVLAPYIGDDLLQSIRMNHAVFVSYASLRRLTGPPSP
SASLLLTRLQTGVTAPDMPGLLASRLRTVLSQTVEASGARQVSELRQQQVSLYTRFLAVL
GCVALLVGSLGITNVMLASVSERKTEIGLRMALGAHTTDVVAQFLTESVLICLLGAALGL
ALGIVGAGVALTVAQIGITLDITTPLCSAVLALLCGLAAGAYPAANAARLDPVTLLQGRG