Protein Info for RS_RS22935 in Ralstonia solanacearum GMI1000

Annotation: oligosaccharide repeat unit polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 156 to 188 (33 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 335 to 351 (17 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details TIGR04370: oligosaccharide repeat unit polymerase" amino acids 11 to 369 (359 residues), 172.3 bits, see alignment E=8e-55

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RS03146)

Predicted SEED Role

"Membrane protein involved in the export of O-antigen and teichoic acid"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XQM0 at UniProt or InterPro

Protein Sequence (390 amino acids)

>RS_RS22935 oligosaccharide repeat unit polymerase (Ralstonia solanacearum GMI1000)
MNKTEIMRDMIVSPPIIFLAAWSMQVIGHTLLQRDFDKFSDHTWWLLAAAAFSFILGCAF
VTFTYIGRRRPNRGITPSKLRGGKRAFWILLTAYGIFGLAPIINILLDQGSISGARDAIV
KGIESRNDSIVRSYYFSALLVVFAVYLVSQASHYSPGFLVIGFVAATVAAISSSGRTLLL
LLFTSTPVSLYLQNKIRKKTFFASLLVFLCFFLALAVLNGKGAFINDLYSQITWNLEVYV
LNGLASFNHFVTNNHPSFDGNILVPNLLRRIFELEGDAIPLVLPFVETPFPGNVYTALYP
WYHDGGALGLMVGFFLIGAFSQYFYHARHKSFKHTFYYSISAYALIMTIFQDQYIQAYPL
WMMAILSPFLASALTPKMRKPSIIKAKTEE