Protein Info for RS_RS16660 in Ralstonia solanacearum GMI1000

Annotation: chromosome partitioning protein ParB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 32 to 213 (182 residues), 200.5 bits, see alignment E=1e-63 PF02195: ParBc" amino acids 36 to 128 (93 residues), 100.5 bits, see alignment E=4.9e-33 PF17762: HTH_ParB" amino acids 178 to 227 (50 residues), 65.8 bits, see alignment 2.5e-22

Best Hits

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to rso:RSc3325)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XU68 at UniProt or InterPro

Protein Sequence (303 amino acids)

>RS_RS16660 chromosome partitioning protein ParB (Ralstonia solanacearum GMI1000)
MSTLKKKGLGRGLEALLGSPAEIVEVARQDGAPTVLKLEQMQPGKYQPRTRMDEGALQEL
AASIRAQGLMQPILVRKVDSDGAAQKYEIIAGERRFRASRLAGLTEVPVLVKDVPDEAAA
AMALIENIQREDLNPLEEAQGIARLIREFQFTHEQAAESLGRSRSAVSNLLRLLNLAQPV
QTMLMAGDLDMGHARTLLAVDGASQITLANQIINKRLSVRETEKLVASTLKPFELKSQRQ
KNGQNGRDVARLEEELADMLGLPVQIKLAAKGRGQLTVQFGSLDEFDGLLARLRPDGADE
AVA