Protein Info for RS_RS16655 in Ralstonia solanacearum GMI1000

Annotation: ATP synthase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 74 to 94 (21 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details PF03899: ATP-synt_I" amino acids 76 to 177 (102 residues), 49.2 bits, see alignment E=3e-17

Best Hits

KEGG orthology group: K02116, ATP synthase protein I (inferred from 100% identity to rso:RSc3324)

Predicted SEED Role

"ATP synthase protein I" in subsystem F0F1-type ATP synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XU69 at UniProt or InterPro

Protein Sequence (190 amino acids)

>RS_RS16655 ATP synthase subunit I (Ralstonia solanacearum GMI1000)
MMKDASSMQPTERQRPDSQASSEDARSRPVPAPKRDWDAEDAEKAGPPVHALSHDEAVAL
FGEKALRASRVTPFSIVLGQVAITLLCALGWYVGSWLAGTGAASAGEAALSALLGGGVCV
VPSAWFALRLSKAQGFESIARLVVGEAIKVLGTVALLVVVVVTFKGLHWAPLLITLILAL
KMYWVGFALR