Protein Info for RS_RS16530 in Ralstonia solanacearum GMI1000

Annotation: potassium transporter Kef

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 340 to 357 (18 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 23 to 393 (371 residues), 85.4 bits, see alignment E=1.9e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc3299)

Predicted SEED Role

"Kef-type K+ transport systems, membrane components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XU94 at UniProt or InterPro

Protein Sequence (407 amino acids)

>RS_RS16530 potassium transporter Kef (Ralstonia solanacearum GMI1000)
MSAMTGLHDLFPSWPPAPGGLFWIGLALVGAALCGEFARVALKLPRIVGYAVAGLAAGVL
GRPLIDADMLGETHILIEMALALALFELGHRLSFDWLRANRWLLLTSAFESLLTWGLVTW
LLQAIGVAVPVAVAAGAIAVATSPTVLLQLKNELRAEGQVTERLLSLGALNSIYAGVLVP
LTAGWLHSEYGHWGAALLHPLYLLVGSVLLAWVTGKAGHALYHRMAGDDHYAFLVLVGLV
LFTLALTKLLKLSVPLTLLLAGVVFKHQDAHPSVWPTHFGSAGSILIVVMIVSLGLPLRA
SDWMIGGVAAVVLVLARFVAKLAGTTLLGSFSGLSMRQSVSLGLALGPMSGLSWLLMHDT
AALYPLTGAPLSAIILCTLAIQQIAAPILTTRALRWAGEVRQEEGRR