Protein Info for RS_RS14010 in Ralstonia solanacearum GMI1000

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details PF00892: EamA" amino acids 135 to 263 (129 residues), 66.6 bits, see alignment E=1.4e-22

Best Hits

Swiss-Prot: 47% identical to RHTA_SALTS: Threonine/homoserine exporter RhtA (rhtA) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: None (inferred from 100% identity to rso:RSc2802)

MetaCyc: 48% identical to L-threonine/L-homoserine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN0-0244

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XVM8 at UniProt or InterPro

Protein Sequence (278 amino acids)

>RS_RS14010 EamA family transporter (Ralstonia solanacearum GMI1000)
MLALLGSMASVCVGNSFAKTLFPALGAAGTVTYRITIGAAILLALWRPWRLRLHRRDAGR
IALYGVTLASMNLLFYLSLTRLPIGIAIAIEFTGPLVLAVALSRRALDFVWIGLAVAGLL
ILTVGGRAVGQIDPLGAAYALGAGVCWALYIVTGKRVGTLPAGQATSLGMAVGALFAIPF
GVVQAGPALLAPSLIVAGLGLGVLSSAVPYSLEMVALRHLSGRTFSVLLSLEPAIGALAG
AVVLHEHLSARQWVAIVAIIAASAGCAATARSRRAAEA