Protein Info for RS_RS13240 in Ralstonia solanacearum GMI1000

Annotation: imidazolonepropionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 327 to 344 (18 residues), see Phobius details amino acids 356 to 380 (25 residues), see Phobius details TIGR01224: imidazolonepropionase" amino acids 29 to 405 (377 residues), 471.8 bits, see alignment E=6.7e-146 PF01979: Amidohydro_1" amino acids 66 to 402 (337 residues), 67.8 bits, see alignment E=1.1e-22 PF07969: Amidohydro_3" amino acids 115 to 384 (270 residues), 51.6 bits, see alignment E=1.2e-17

Best Hits

Swiss-Prot: 100% identical to HUTI_RALSO: Imidazolonepropionase (hutI) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 100% identity to rso:RSc2644)

MetaCyc: 62% identical to imidazolonepropionase (Pseudomonas fluorescens)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XW31 at UniProt or InterPro

Protein Sequence (408 amino acids)

>RS_RS13240 imidazolonepropionase (Ralstonia solanacearum GMI1000)
MADIRWDALWTHVHLATLAADADGYGEIRDGAIAVRDGRIAWLGARADLPAGARAEREHD
GGGAWLTPGLIDCHTHLVHAGNRSNEFEARLNGVPYEHIARAGGGILSTVRATRAASEDA
LAQASLPRLNALRAEGVTTVEIKSGYGLDLETERRMLRVARRFGQTLRVRVRTTFLGAHA
VPPEFAGRADDYIGHLCADVLPALAAEGLVDAVDAFCETIGFSPAQTARMFDAAQALGLP
VKLHAEQLSDQGGAALVARYGGLSADHLECLTDAGVAAMAEAGTVAVLLPGAFYCLRETR
LPPLQALRQAGVPMAVSTDCNPGTSPLSSLLLAMNMACTLFRLTPLEALTGATRHAAAAL
GLAGTCGVLAPGCVADFALWRIDRPADLAYAMGLNPCAGVVKDGAPAR