Protein Info for RS_RS10745 in Ralstonia solanacearum GMI1000

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 308 (204 residues), 67.1 bits, see alignment E=9e-23

Best Hits

KEGG orthology group: K10228, sorbitol/mannitol transport system permease protein (inferred from 100% identity to rso:RSc2143)

MetaCyc: 60% identical to polyol ABC-type transporter permease component MtlF (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 1" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XXH1 at UniProt or InterPro

Protein Sequence (313 amino acids)

>RS_RS10745 sugar ABC transporter permease (Ralstonia solanacearum GMI1000)
MRHLHLSFSHTTAVGKPASPSAPRRRDGASWLVSPSVAALLLWMSIPLAMTIWFSFSRYN
LLNPDVKGFAGFDNYHFLATDPSFGPAIWHTLALIGAVLVITVVGGVLTAVLFDRKFYGQ
GIARLLMIAPFFVMPTVSALIWKNMILHPVYGLVASAMRAVGLTPIDWFADYPLTAVVII
VAWQWLPFAFLILFTAIQSLDQEQKEAARIDGAGPIAMFFYITLPHLKRAIAVVVMMETI
FLLSIFAEIYTTTGGGPGNATTNLSYLIYALGLQQFDVGLASAGGILAVVVANIVSFFLV
RMLAKNLKGEYQQ